Arabidopsis monogalactosyldiacylglycerol desaturase

(palmitate-specific) (FAD5) is possibly similar to animal

 and fungal acyl-CoA desaturases

 

Genes or clones have previously been identified for 6 of the 8 acyl desaturase reactions shown in Figure 2.  However, FAD4 and FAD5 are so far identified only by the existence of putative mutations in these reactions (reactions #15 and #20 in Figure 2). One of the most intriguing differences in the abundance of ESTs between rice and Arabidopsis concerns a gene family that is most similar to animal and fungal acyl-CoA desaturases. There are 10 independent ESTs in Arabidopsis, 4 in tomato and 2 in Brassica, but this sequence class is completely missing from rice.  At this time the precise function of these desaturase-like genes remains unknown.  However, further analysis suggests that members of this family encode acyl-lipid desaturases which likely include palmitate-specific monogalactosyldiacylglycerol desaturase (FAD5).

            In animals and yeast this class of desaturase genes encodes palmitoyl and stearoyl delta 9 desaturases, which use acyl-CoA (or possibly acyl-lipids) as substrate (Stukey et al., 1989; Stukey et al., 1990; Thiede et al., 1986).  However, desaturation at the delta 9 position in higher plants is catalyzed by stearoyl-ACP desaturases and the currently established pathway of higher plant glycerolipid biosynthesis does not involve any other steps of delta 9 desaturation. Thus, it is possible that enzymes encoded by this gene family are responsible for another reaction(s) which is similar to desaturation of palmitoyl and stearoyl at the delta 9 position.

     The most obvious candidates for these reactions would be desaturation of palmitoyl at the delta 7 position on monogalactosyldiacylglycerol or at the delta 3 (trans) position on phosphatidylglycerol, the reactions that have been associated with Arabidopsis mutations fad4 (delta 3) and fad5 (delta 7) (Browse, 1985; Kunst, 1989).  Because desaturation of palmitate at delta 3 and delta 7 in higher plants occurs in the chloroplasts the corresponding enzymes should be synthesized as precursors with chloroplast transit peptides. We did multiple alignment analysis of amino acid sequences for all cDNA, genomic and EST clones of higher plants similar to delta 9 acyl-CoA desaturases (see the alignment below). Surveying genomic Arabidopsis sequences that have not been annotated we identified a tandem of genes in chromosome 3 that encodes two proteins similar to animal and fungal acyl-CoA and acyl-lipid desaturases (AB017071). When aligned with similar proteins these sequences which we name putative FAD5_1 and FAD5_2 have N-terminal extensions which are recognized as chloroplast transit peptides by ChloroP software.  The fad5 mutation has been mapped in chromosome 3, at 28±6 cM from locus gl1 (Hugly, 1991). Clone MSJ11 (AB017071) with the putative gene FAD5 is located at the distance 27.9 cM from the clone with GL1 and in the same relative position to locus tt5 (http://genome‑www3.stanford.edu/cgi‑bin/AtDB/SEQmap?chr=3&beg=19&end=24æ).Thus, it is likely that we have identified genomic sequences which are strong candidates for plastidial palmitate-specific monogalactosyldiacylglycerol desaturase.  Putative gene FAD5_1 does not have ESTs in Arabidopsis. However, searching dbEST with the amino acid sequence of the protein encoded by FAD5_1 we found 2 similar EST sequences in Brassica which overlap with the predicted transit peptide (L38104 and  H07631). Thus, in other cruciferous plants protein products of similar genes are  likely to be imported into chloroplasts. Gene FAD5_2 in Arabidopsis is represented by EST clones 145O4 (AI099992 and T76134) and 122A14 (R87006). Both clones appear to be full length and have the sequence corresponding to the predicted transit peptide. We also identified ESTs similar to animal and fungal acyl-CoA and acyl-lipid desaturases with potential chloroplast transit peptides from tomato and Chlamydomonas.

            Finally, we note that occurrence of the transcripts similar to delta 9 acyl desaturases in Arabidopsis, Brassica, tomato and Chlamydomonas and their apparent absence in rice correlate with our biochemical understanding of desaturation patterns of acyl residues in the sn-2 position of DGG in these species.  All species which contain these sequences are considered "16:3 plants" and carry out delta 7 desaturation of palmitate, as opposed to many other angiosperms, including rice (Mongrand et al., 1998), which are “18:3" plants and lack this reaction. The ESTs similar to delta 9 acyl desaturases are clearly associated with the 16:3 phenotype. Thus, based on four criteria: sequence similarity to acyl-CoA desaturases, presence of transit peptides, chromosomal location, and association with the 16:3 phenotype, our survey of public databases has provided strong evidence for the function of one of the previously unidentified members of the desaturase gene family in plants.

 

 

Potential transit peptides encoded by plant ESTs and Arabidopsis genomic sequences

similar to animal and fungal acyl-CoA desaturases are shown by green arrows.

 

Accession numbers for ESTs are highlighted with yellow.

 

At T46147     : ------------------------------------------------------------------------------------------------
At AA041026   : ------------------------------------------------------------------------------------------------
At Z30751     : ------------------------------------------------------------------------------------------------
At ADS1       : ------------------------------------------------------------------------------------------------
At AA586250   : ------------------------------------------------------------------------------------------------
At Z35340     : ------------------------------------------------------------------------------------------------
At T20690     : ------------------------------------------------------------------------------------------------
At N97264     : ------------------------------------------------------------------------------------------------
At R90185     : ------------------------------------------------------------------------------------------------
At T42777     : ------------------------------------------------------------------------------------------------
At R65180     : ------------------------------------------------------------------------------------------------
At T88304     : ------------------------------------------------------------------------------------------------
At Z35339     : ------------------------------------------------------------------------------------------------
At Z32595     : ------------------------------------------------------------------------------------------------
At N96488     : ------------------------------------------------------------------------------------------------

 

Tomato        : ---------------------------------RIRHELLSPPPSKSKPYPFSPLPRAVHRQGRSTQTTKNVNSLSCTSMTTKIGVVNKWNCYGLE
At ADS2       : ------------------------------------------------------------------------------------------------

 

At AI099992   : ------------------------------------------------------------------------------------------------

At T76134     : ----------------------------------------------------------------MASXLTKPKPVFLCXPSLSPRTLNTATPSLNX
At R87006     : ----------------------------------------------------------------MASXLTKPKPVFLCXPSXSPRTLNTATPSLNL
At FAD5_1     : ----------------------------------------------------------------
MASLLTKPKPVFLCSPSLSPRTLNTATPSLNF

 

Brassica      : ----------------------------------------------------------------MVSLCTTLKPLSPFXPFV--KQGNLNYTSALL

At FAD5_2     : ----------------------------------------------------------------MMSLSTTLKPLSHFSPFV--KRHNPKTNNTLF

 

Chlamidomonas : QVERRKCLGCGTSTCAGLSAACAVRTXPPLHQLRPASQPCCSSGQPWACARRRAAGSGRRGAAASKYMRPLRLGSRVLGLPRLAGGQRGGRVPPPG
ROSE          : ------------------------------------------------------------------------------------------------
 

 

 

 

 

 

 

 

 

 

At T46147     : ------------------------------------------------------------------------------------------------
At AA041026   : ---------------------------------------------------
GAVSKEKR--PYIHREWSWADIIRALTVINVHFLCLLA--PFNYK
At Z30751     : -------------------------------------------------------------AMWERKWKRLDIVKAFASLFVHFLCLLA--PFNFT
At ADS1       : ----------------
MSLSASEKE----------------ENNKKMAADKAEMGRKKR--AMWERKWKRLDIVKAFASLFVHFLCLLA--PFNFT
At AA586250   : ------------------------------------------------------------------------------------------------
At Z35340     : ------------------------------------------------------------------------------------------------
At T20690     : ------------------------------------------------------------------------------------------------
At N97264     : ----------------MSVTSTVEE----------------NHQKNPSTPAGWEEKKKRRWVFWDRRWRRLDYVKXSASFTVHSLALLA--PFYFT
At R90185     : -----------------SVTSTVEE----------------NHQKNPSTPAGWEEKKKRRWVFWXRRWRRLDYXKXSASXTVHSLALLA--PFXXT
At T42777     : -----------------SVTSTVEE----------------NHQKNPSTPAGWXEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLA--PFYFT
At R65180     : ----------------------------------------------------------------------LDYVKFSASFTVHSLALLA--PFYFT
At T88304     : -----------------SVTSTVEE----------------NHQKNPSTPAGWEEKKKRRWVFWDRRWRRLDYXKFSXSXTVHXLALLA--PFXFT
At Z35339     : ----------------MSVTSTVEE----------------NHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLA--PFYFT
At Z32595     : ----------------MSVTSTVEE----------------NHQKNPSTPAAVEEKKKRRWVLWYRRWRRLDYVKFSASHTAHSLALLA--PFYHT
At N96488     : ---------------------TVEE----------------NHQKNPSTPAGWXEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLA--PFYFT

 

Tomato        : GKVRFSRRVMLMPIVNAAVTQPVSENERESNFKRILLSDVVVTRPRDVLWG-------RKW-------NSMDMASAAVVVSMHLLCLFA--PFTFN
At ADS2       : ----------------
MSVTSTVEE----------------NHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLA--PFYFT

 

At AI099992   : ------------------------------------------------------------------------------------------------
At T76134     : T
RISFTHHQKLAPXKPPSL--VVAFSEKGLKRDVTTAAAATEGDYRRXMLSXVLVKKKEKVVWWEXXWESYGLWGCXXXVLXM-------------
At R87006     : TRIXFTHHQKLAPXKPPSL--VVAFXEKGLKRDVTTAAAATEGDYRRXMLSXVLVKEEGKSSLV--------------------------------
At FAD5_1     :
TRISFTHHQKLAPFKPPSL--VVAFSEKGLKRDVTTAAAATEGDYRRIMLSDVLVKKKEKVVWWEREWKAMDFGAVAVVLSMHLLSLLA--PFQFN

 

Brassica      : TYRTSNSANSFLPKRGGTV-AVHDAP------------DQVESSCRIPLTEVVAVRKK--SAFWERSWSSRDVRNVVVLGGVHLLSLFG--PLYFS
At FAD5_2     :
TLDTHNFTNSFWSKRGGSVSAVYEAP------------DHVESSWRRLLSEVVVVRTKR--SFWERSWTSWDVSKLVIFVGTHLLSLLA--PFYFS

 

Chlamidomonas : GGRLGLHVLXSAVRQALHQASRAIGAGDAQGDQQAGXGCAEQRGGCFQGLCVGCACSGKRPLWFGRKWSITDISYGVYLGGMHLLACLA--PFTFS
ROSE          : ------------------------------------------
------MPSRLINWQVQ---FFGREWDFMDLYHLTLFLGVPFVCLLA--PFQFT